SCOPe 2.08: Structural Classification of Proteins

PDB entry 1tyf

View 1tyf on RCSB PDB site
Description: the structure of clpp at 2.3 angstrom resolution suggests a model for ATP-dependent proteolysis
Class: peptidase
Keywords: peptidase
Deposited on 1997-10-13, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfa_
Chain 'B':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfb_
Chain 'C':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfc_
Chain 'D':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfd_
Chain 'E':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfe_
Chain 'F':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyff_
Chain 'G':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfg_
Chain 'H':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfh_
Chain 'I':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfi_
Chain 'J':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfj_
Chain 'K':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfk_
Chain 'L':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfl_
Chain 'M':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfm_
Chain 'N':
Compound: clp peptidase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6G7 (Start-192)
Domains in SCOPe 2.08: d1tyfn_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1tyfA (A:)
alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
eyglvdsilthrn