PDB entry 1tsj

View 1tsj on RCSB PDB site
Description: Crystal structure of protein from Staphylococcus aureus
Class: structural genomics, unknown function
Keywords: conserved hypothetical protein, Structural Genomics, Protein Structure Initiative, PSI, NYSGXRC, New York SGX Research Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-06-21, released 2004-12-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conserved hypothetical protein
  Species: Staphylococcus aureus subsp. aureus [TaxId:46170]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8NX24 (0-124)
    • modified residue (10)
    • modified residue (34)
    • modified residue (61)
    • modified residue (85)
    • modified residue (100)
    • modified residue (105)
  Domains in SCOPe 2.04: d1tsja_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1tsjA (A:)
  mdipkittflmfnnqaeeavklytslfedseiitmakygengpgdpgtvqhsiftlngqv
  fmaidansgtelpislfvtvkdtiemerlfnglkdegailmpktnmppyrefawvqdkfg
  vsfqlalpeeggshhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1tsjA (A:)
  mdipkittflmfnnqaeeavklytslfedseiitmakygdpgtvqhsiftlngqvfmaid
  pislfvtvkdtiemerlfnglkdegailmpktnmppyrefawvqdkfgvsfqlalpe