PDB entry 1tkw

View 1tkw on RCSB PDB site
Description: The transient complex of poplar plastocyanin with turnip cytochrome f determined with paramagnetic NMR
Class: photosynthesis
Keywords: Electron transfer, photosynthesis, NMR, paramagnetic, rigid body calculations
Deposited on 2004-06-09, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin a
    Species: Populus nigra [TaxId:3691]
    Gene: PETE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tkwa_
  • Chain 'B':
    Compound: cytochrome f
    Species: Brassica rapa subsp. rapa [TaxId:51350]
    Gene: PETA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tkwA (A:)
    idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
    dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn
    

  • Chain 'B':
    No sequence available.