PDB entry 1t9h

View 1t9h on RCSB PDB site
Description: The crystal structure of YloQ, a circularly permuted GTPase.
Class: hydrolase
Keywords: N-terminal beta-barrel domain with Oligonucleotide Binding fold, central GTP binding domain, C-terminal zinc-binding domain, HYDROLASE
Deposited on 2004-05-17, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.146
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable GTPase engC
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ENGC, BSU15780
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34530 (9-306)
      • expression tag (1-8)
    Domains in SCOPe 2.07: d1t9ha1, d1t9ha2, d1t9ha3
  • Heterogens: IUM, ZN, CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9hA (A:)
    marhhhhhhmpegkiikalsgfyyvldesedsdkviqcrgrgifrknkitplvgdyvvyq
    aendkegylmeikertnelirppicnvdqavlvfsavqpsfstalldrflvlveandiqp
    iicitkmdliedqdtedtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfag
    qsgvgkssllnaispelglrtneisehlgrgkhttrhvelihtsgglvadtpgfssleft
    dieeeelgytfpdireksssckfrgclhlkepkcavkqavedgelkqyrydhyvefmtei
    kdrkpry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9hA (A:)
    arhhhhhhmpegkiikalsgfyyvldesedsdkviqcrgrgifrknkitplvgdyvvyqa
    endkegylmeikertnelirppicnvdqavlvfsavqpsfstalldrflvlveandiqpi
    icitkmdliedqdtedtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfagq
    sgvgkssllnaisptrhvelihtsgglvadtpgfssleftdieeeelgytfpdireksss
    ckfrgclhlkepkcavkqavedgelkqyrydhyvefmteikdrkpry