PDB entry 1sta

View 1sta on RCSB PDB site
Description: accommodation of insertion mutations on the surface and in the interior of staphylococcal nuclease
Deposited on 1994-01-17, released 1994-06-22
The last revision prior to the SCOP 1.63 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1sta__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sta_ (-)
  lhkepggatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkk
  mvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqh
  lrkseaqakkeklniws