PDB entry 1smt

View 1smt on RCSB PDB site
Description: smtb repressor from synechococcus pcc7942
Class: metalloregulation
Keywords: metalloregulation, DNA repressor
Deposited on 1997-09-16, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional repressor smtB
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smta_
  • Chain 'B':
    Compound: Transcriptional repressor smtB
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smtb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1smtA (A:)
    mtkpvlqdgetvvcqgthaaiaselqaiapevaqslaeffavladpnrlrllsllarsel
    cvgdlaqaigvsesavshqlrslrnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqe
    cr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smtA (A:)
    elqaiapevaqslaeffavladpnrlrllsllarselcvgdlaqaigvsesavshqlrsl
    rnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1smtB (B:)
    mtkpvlqdgetvvcqgthaaiaselqaiapevaqslaeffavladpnrlrllsllarsel
    cvgdlaqaigvsesavshqlrslrnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqe
    cr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smtB (B:)
    aiaselqaiapevaqslaeffavladpnrlrllsllarselcvgdlaqaigvsesavshq
    lrslrnlrlvsyrkqgrhvyyqlqdhhivalyqnaldhlqe