PDB entry 1sg3

View 1sg3 on RCSB PDB site
Description: Structure of allantoicase
Class: hydrolase
Keywords: allantoicase, jelly roll, hexamer, HYDROLASE
Deposited on 2004-02-23, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Allantoicase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DAL2, ALC1, YIR029W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sg3a1, d1sg3a2
  • Chain 'B':
    Compound: Allantoicase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DAL2, ALC1, YIR029W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25335 (0-342)
      • expression tag (343)
    Domains in SCOPe 2.07: d1sg3b1, d1sg3b2, d1sg3b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sg3A (A:)
    mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdptr
    fvhsgawydgwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealyd
    egeegniveddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrl
    ygrvvppelktkdhiidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsr
    qpghtdwaviqlgressfiekiivdtahfrgnfpqfitvegclkesessentgegtwvel
    vgksktgpdkehvyeirksirvshvkltiipdggvkrirvwgyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg3A (A:)
    mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdwyd
    gwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealydegeegnive
    ddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrlygrvvppii
    dlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgres
    sfiekiivdtahfrgnfpqfitvegclkgtwvelvgksktgpdkehvyeirksirvshvk
    ltiipdggvkrirvwgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sg3B (B:)
    mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdptr
    fvhsgawydgwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealyd
    egeegniveddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrl
    ygrvvppelktkdhiidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsr
    qpghtdwaviqlgressfiekiivdtahfrgnfpqfitvegclkesessentgegtwvel
    vgksktgpdkehvyeirksirvshvkltiipdggvkrirvwgyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg3B (B:)
    mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdwyd
    gwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealydegeegnive
    ddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrlygrvvppii
    dlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgres
    sfiekiivdtahfrgnfpqfitvegclktwvelvgksktgpdkehvyeirksirvshvkl
    tiipdggvkrirvwgyh