PDB entry 1sdy

View 1sdy on RCSB PDB site
Description: structure solution and molecular dynamics refinement of the yeast cu,zn enzyme superoxide dismutase
Class: oxidoreductase(superoxide acceptor)
Keywords: oxidoreductase(superoxide acceptor)
Deposited on 1991-06-14, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sdya_
  • Chain 'B':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sdyb_
  • Chain 'C':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sdyc_
  • Chain 'D':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sdyd_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdyA (A:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdyB (B:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdyC (C:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdyD (D:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn