PDB entry 1sb0

View 1sb0 on RCSB PDB site
Description: Solution structure of the KIX domain of CBP bound to the transactivation domain of c-Myb
Class: Transcription
Keywords: CREB-binding protein; transcriptional activation; constitutive activation; LXXLL motif; Myb; KIX
Deposited on 2004-02-09, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein CBP
  Species: Mus musculus [TaxId:10090]
  Gene: CBP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45481 (0-86)
  Domains in SCOPe 2.08: d1sb0a_
• Chain 'B':
  Compound: protein c-Myb
  Species: Mus musculus [TaxId:10090]
  Gene: c-Myb
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06876 (0-24)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sb0A (A:)
  gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
  rdeyyhllaekiykiqkeleekrrsrl
  

  
  
• Chain 'B':
  No sequence available.