PDB entry 1s6a

View 1s6a on RCSB PDB site
Description: The X-ray structure of the cyanobacteria Synechocystis hemoglobin "cyanoglobin" with azide ligand
Class: oxygen storage/transport
Keywords: 2 on 2 helical fold, globin, heme, iron, hemoglobin, cyanobacteria, oxygen binding, hexacoordinate, truncated, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2004-01-22, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.198
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanoglobin
    Species: Synechocystis sp. [TaxId:1148]
    Gene: GLBN, SLR2097
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s6aa_
  • Heterogens: FLC, AZI, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s6aA (A:)
    mstlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdk
    ydgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrd
    vlnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s6aA (A:)
    stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
    dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
    lnq