PDB entry 1rnh

View 1rnh on RCSB PDB site
Description: structure of ribonuclease h phased at 2 angstroms resolution by mad analysis of the selenomethionyl protein
Deposited on 1990-07-11, released 1991-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1rnh__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rnh_ (-)
  lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealke
  hcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwewv
  kghaghpenercdelaraaamnptledtgyq