PDB entry 1rlc

View 1rlc on RCSB PDB site
Description: crystal structure of the unactivated ribulose 1, 5-bisphosphate carboxylase(slash)oxygenase complexed with a transition state analog, 2-carboxy-d-arabinitol 1,5-bisphosphate
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1993-08-04, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.196
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA77361
    Domains in SCOPe 2.07: d1rlcl1, d1rlcl2
  • Chain 'S':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rlcs_
  • Heterogens: CAP

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rlcL (L:)
    mspqtetkasvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsr
    giyftqdwvslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvkarnegrdlaqegneiireackwspelaaacevwkeivfnfaavdvldk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlcL (L:)
    ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstvwtdgltsldrykgrcyr
    iervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrippayvk
    tfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenv
    nsqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivm
    hdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhi
    hsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwh
    mpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiir
    eackwspelaaacevwkeivf
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rlcS (S:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
    egy