PDB entry 1re2

View 1re2 on RCSB PDB site
Description: human lysozyme labelled with two 2',3'-epoxypropyl beta-glycoside of n-acetyllactosamine
Class: lysozyme
Keywords: lysozyme, muramidase, ec 3.2.1.17, hydrolase(o-glycosyl), n-acetyllactosamine, affinity labeling
Deposited on 1998-11-05, released 1999-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lysozyme)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1re2a_
  • Heterogens: GAL, NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1re2A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv