PDB entry 1r29

View 1r29 on RCSB PDB site
Description: Crystal Structure of the B-Cell Lymphoma 6 (BCL6) BTB Domain to 1.3 Angstrom
Class: transcription
Keywords: BTB domain, B-cell lymphoma, transcriptional repression, TRANSCRIPTION
Deposited on 2003-09-26, released 2003-12-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.131
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182
      • engineered (5)
      • engineered (64)
      • engineered (81)
    Domains in SCOPe 2.03: d1r29a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1r29A (A:)
gsadsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysift
dqlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcr
kfikase

    Sequence, based on observed residues (ATOM records): (download) 
    >1r29A (A:)
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as