PDB entry 1qu5

View 1qu5 on RCSB PDB site
Description: nmr structure of a new phosphotyrosine binding domain containing the fha2 domain of rad 53
Class: transferase
Keywords: fha, rad53, transferase
Deposited on 1999-07-06, released 1999-12-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase spk1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qu5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qu5A (A:)
eaetreqkllhsnntenvksskkkgngrfltlkplpdsiiqesleiqqgvnpffigrsed
cnckiednrlsrvhcfifkkrhavgksmyespaqglddiwychtgtnvsylnnnrmiqgt
kfllqdgdeikiiwdknnkfvigfkveindttglfneglgmlqeqrvvlkqtaeekdlvk
kl