PDB entry 1qpm

View 1qpm on RCSB PDB site
Description: nmr structure of the mu bacteriophage repressor DNA-binding domain
Class: Viral protein
Keywords: helix-turn-helix, mu bacteriophage, repressor, viral protein
Deposited on 1999-05-26, released 1999-06-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mu bacteriophage c repressor protein)
    Species: Enterobacteria phage Mu [TaxId:10677]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpmA (A:)
    ksiwcspqeimaadgmpgsvagvhyranvqgwtkrkkegvkggkaveydvmsmptkereq
    viahlglst