PDB entry 1qmc

View 1qmc on RCSB PDB site
Description: C-terminal DNA-binding domain of HIV-1 integrase, NMR, 42 structures
Class: transferase
Keywords: integrase, DNA-binding protein, src homology 3 (sh3)-like fold, aids, polyprotein, transferase
Deposited on 1999-09-27, released 1999-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 integrase
  Species: Human immunodeficiency virus type 1 BH10 [TaxId:11678]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (1-51)
    • cloning artifact (0)
  Domains in SCOPe 2.07: d1qmca1, d1qmca2
• Chain 'B':
  Compound: hiv-1 integrase
  Species: Human immunodeficiency virus type 1 BH10 [TaxId:11678]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (1-51)
    • cloning artifact (0)
  Domains in SCOPe 2.07: d1qmcb1, d1qmcb2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qmcA (A:)
  miqnfrvyyrdsrnplwkgpakllwkgegavviqdnsdikvvprrkakiird
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qmcB (B:)
  miqnfrvyyrdsrnplwkgpakllwkgegavviqdnsdikvvprrkakiird