PDB entry 1qjj

View 1qjj on RCSB PDB site
Description: structure of astacin with a hydroxamic acid inhibitor
Deposited on 1999-06-24, released 2000-01-24
The last revision prior to the SCOP 1.57 freeze date was dated 2000-01-24, with a file datestamp of 2000-01-24.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.161
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1qjja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qjjA (A:)
aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
hmlqtdanqinnlytnecsl