PDB entry 1qhs

View 1qhs on RCSB PDB site
Description: chloramphenicol phosphotransferase in complex with chloramphenicol from streptomyces venezuelae
Deposited on 1999-05-27, released 2000-06-01
The last revision prior to the SCOP 1.57 freeze date was dated 2000-06-01, with a file datestamp of 2000-06-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1qhsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qhsA (A:)
mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg
gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr
cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp