PDB entry 1qck

View 1qck on RCSB PDB site
Description: solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure plus 20 individual simulated annealing structures
Class: DNA binding protein
Keywords: DNA-binding protein, integration, aids, retroviruses, DNA binding protein
Deposited on 1999-05-06, released 1999-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (barrier-to-autointegration factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qcka_
  • Chain 'B':
    Compound: protein (barrier-to-autointegration factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qckb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qckA (A:)
    mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
    ewlkdtcganakqsrdcfgclrewcdafl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qckB (B:)
    mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
    ewlkdtcganakqsrdcfgclrewcdafl