PDB entry 1qck
View 1qck on RCSB PDB site
Description: solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure plus 20 individual simulated annealing structures
Class: DNA binding protein
Keywords: DNA-binding protein, integration, aids, retroviruses, DNA binding protein
Deposited on
1999-05-06, released
1999-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (barrier-to-autointegration factor)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1qcka_ - Chain 'B':
Compound: protein (barrier-to-autointegration factor)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1qckb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1qckA (A:)
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1qckB (B:)
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl