PDB entry 1qas

View 1qas on RCSB PDB site
Description: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1
Class: hydrolase
Keywords: hydrolase, lipid degradation, transducer, calcium-binding
Deposited on 1996-08-02, released 1997-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase c delta-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qasa1, d1qasa2, d1qasa3
  • Chain 'B':
    Compound: phospholipase c delta-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qasb1, d1qasb2, d1qasb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qasA (A:)
    mdqrqklqhwihsclrkadknkdnkmnfkelkdflkelniqvddgyarkifrecdhsqtd
    sledeeietfykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalsl
    ieryepsetakaqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshnty
    lledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrair
    dyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgk
    illkgkklggllpaggengseatdvsdeveaaemedeavrsqvqhkpkedklklvpelsd
    miiycksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhnvsclsriypag
    wrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaflrdpntt
    fnsraltqgpwwrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtav
    itnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvh
    llskngdqhpsatlfvkisiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qasA (A:)
    ykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslieryepseta
    kaqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshntylledqltgps
    steayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafkaspyp
    vilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgkillkgkklgg
    klvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhnvsc
    lsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpa
    flrdpnttfnsraltqgpwwrperlrvriisgqqlpkvnivdpkviveihgvgrdtgsrq
    tavitnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyr
    hvhllskngdqhpsatlfvkisiqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qasB (B:)
    mdqrqklqhwihsclrkadknkdnkmnfkelkdflkelniqvddgyarkifrecdhsqtd
    sledeeietfykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalsl
    ieryepsetakaqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshnty
    lledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrair
    dyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgk
    illkgkklggllpaggengseatdvsdeveaaemedeavrsqvqhkpkedklklvpelsd
    miiycksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhnvsclsriypag
    wrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaflrdpntt
    fnsraltqgpwwrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtav
    itnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvh
    llskngdqhpsatlfvkisiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qasB (B:)
    kmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslieryepsetak
    aqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshntylledqltgpss
    teayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafkaspypv
    ilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgkillkgkklggl
    klklvpelsdmiiycksvhfggfsspgqafyemasfsesralrllqesgngfvrhnvscl
    sriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaf
    lrdpnttfnsraltqgpwwrperlrvriisgqqlpkvnivdpkviveihgvgrdtgsrqt
    avitnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrh
    vhllskngdqhpsatlfvkisiqd