PDB entry 1pue

View 1pue on RCSB PDB site
Description: pu.1 ets domain-DNA complex
Class: transcription/DNA
Keywords: complex (transcription regulating-DNA), oncogene, transforming protein, DNA- binding, activator, nuclear protein, transcription-DNA complex
Deposited on 1996-07-08, released 1997-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA (5'-d(*ap*ap*ap*ap*ap*gp*gp*gp*gp*ap*ap*gp*tp*gp*gp*g)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'B':
  Compound: DNA (5'-d(*tp*cp*cp*cp*ap*cp*tp*tp*cp*cp*cp*cp*tp*tp*tp*t)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'C':
  Compound: DNA (5'-d(*ap*ap*ap*ap*ap*gp*gp*gp*gp*ap*ap*gp*tp*gp*gp*g)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'D':
  Compound: DNA (5'-d(*tp*cp*cp*cp*ap*cp*tp*tp*cp*cp*cp*cp*tp*tp*tp*t)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'E':
  Compound: protein (transcription factor pu.1 (tf pu.1))
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17433 (0-End)
    • conflict (57)
  Domains in SCOPe 2.07: d1puee_
• Chain 'F':
  Compound: protein (transcription factor pu.1 (tf pu.1))
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17433 (0-88)
    • conflict (57)
  Domains in SCOPe 2.07: d1puef_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >1pueE (E:)
  kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
  aralrnygktgevkkvkkkltyqfsgevl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1pueE (E:)
  kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
  aralrnygktgevkkvkkkltyqfsgev
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pueF (F:)
  kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
  aralrnygktgevkkvkkkltyqfsgevl