PDB entry 1prc

View 1prc on RCSB PDB site
Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis
Class: photosynthetic reaction center
Keywords: photosynthetic reaction center
Deposited on 1988-02-04, released 1989-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: photosynthetic reaction center
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1prcc_
  • Chain 'H':
    Compound: photosynthetic reaction center
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1prch1, d1prch2
  • Chain 'L':
    Compound: photosynthetic reaction center
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1prcl_
  • Chain 'M':
    Compound: photosynthetic reaction center
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1prcm_
  • Heterogens: FE, SO4, BCB, BPB, MQ7, HEM, NS1, UQ1, LDA, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1prcC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpikaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1prcC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpika
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prcH (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveplglvklapedgqvy
    elpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaer
    aevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyf
    rylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsa
    yyaggllyatperaesll
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prcL (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prcM (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk