PDB entry 1plc

View 1plc on RCSB PDB site
Description: accuracy and precision in protein crystal structure analysis: restrained least-squares refinement of the crystal structure of poplar plastocyanin at 1.33 angstroms resolution
Class: electron transport
Keywords: electron transport
Deposited on 1992-03-11, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plastocyanin
  Species: Populus nigra [TaxId:3691]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00299 (0-98)
  Domains in SCOPe 2.07: d1plca_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1plcA (A:)
  idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
  dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn