PDB entry 1pkr

View 1pkr on RCSB PDB site
Description: the structure of recombinant plasminogen kringle 1 and the fibrin binding site
Class: plasminogen
Keywords: plasminogen
Deposited on 1993-08-03, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.159
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pkra_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1pkrA (A:)
secktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpq
gpwcyttdpekrydycdilecd

    Sequence, based on observed residues (ATOM records): (download) 
    >1pkrA (A:)
ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
pwcyttdpekrydycdilec