PDB entry 1pk4

View 1pk4 on RCSB PDB site
Description: crystal and molecular structure of human plasminogen kringle 4 refined at 1.9-angstroms resolution
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease)
Deposited on 1991-07-18, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.142
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen kringle 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pk4a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pk4A (A:)
    dcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkgp
    wcfttdpsvrweycnlkkc