PDB entry 1pcn

View 1pcn on RCSB PDB site
Description: solution structure of porcine pancreatic procolipase as determined from 1h homonuclear two-and three-dimensional nmr
Class: lipase protein cofactor
Keywords: lipase protein cofactor
Deposited on 1994-06-08, released 1994-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: porcine pancreatic procolipase b
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02703 (0-92)
  Domains in SCOPe 2.08: d1pcna1, d1pcna2
• Heterogens: OH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pcnA (A:)
  vpdprgiiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyyk
  cpcergltcegdkslvgsitntnfgichnvgrs