PDB entry 1paf

View 1paf on RCSB PDB site
Description: the 2.5 angstroms structure of pokeweed antiviral protein
Class: protein synthesis inhibitor
Keywords: protein synthesis inhibitor
Deposited on 1992-10-19, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.17
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pokeweed antiviral protein
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pafa_
  • Chain 'B':
    Compound: pokeweed antiviral protein
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pafb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pafA (A:)
    vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
    titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
    sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
    kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
    rvdeikpdvallnyvggscqtt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pafB (B:)
    vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
    titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
    sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
    kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
    rvdeikpdvallnyvggscqtt