PDB entry 1p4t

View 1p4t on RCSB PDB site
Description: Crystal structure of Neisserial surface protein A (NspA)
Class: membrane protein
Keywords: beta barrel, outer membrane protein, MEMBRANE PROTEIN
Deposited on 2003-04-24, released 2003-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.227
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane protein NspA
    Species: Neisseria meningitidis [TaxId:487]
    Gene: nspa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p4ta_
  • Heterogens: SO4, CXE, ETA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p4tA (A:)
    egasgfyvqadaahakassslgsakgfsprisagyrindlrfavdytryknykapstdfk
    lysigasaiydfdtqspvkpylgarlslnrasvdlggsdsfsqtsiglgvltgvsyavtp
    nvdldagyrynyigkvntvknvrsgelsagvrvkf