PDB entry 1p2l

View 1p2l on RCSB PDB site
Description: T4 Lysozyme Core Repacking Mutant V87I/TA
Class: hydrolase
Keywords: hydrolase (o-glycosyl), t4 lysozyme, designed core mutant, automated protein design, protein engineering, protein folding, protein stability, core repacking, dead-end elimination theorem, side-chain packing, optimized rotamer combinations, orbit
Deposited on 2003-04-15, released 2003-10-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.171
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (53)
      • engineered (86)
      • engineered (96)
    Domains in SCOPe 2.04: d1p2la_
  • Heterogens: PO4, K, CL, HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p2lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpiydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl