PDB entry 1ou5

View 1ou5 on RCSB PDB site
Description: Crystal structure of human CCA-adding enzyme
Class: translation, transferase
Keywords: tRNA, polymerase, nucleotidyltransferase, TRANSLATION, TRANSFERASE
Deposited on 2003-03-24, released 2003-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA CCA-adding enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: hMtCCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96Q11 (43-End)
      • cloning artifact (41-42)
    Domains in SCOPe 2.08: d1ou5a1, d1ou5a2, d1ou5a3
  • Chain 'B':
    Compound: tRNA CCA-adding enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: hMtCCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96Q11 (43-End)
      • cloning artifact (41-42)
    Domains in SCOPe 2.08: d1ou5b1, d1ou5b2, d1ou5b3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ou5A (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkmklqspefqslfteglk
    sltelfvkenhelriaggavrdllngvkpqdidfattatptqmkemfqsagirminnrge
    khgtitarlheenfeittlridvttdgrhaevefttdwqkdaerrdltinsmflgfdgtl
    fdyfngyedlknkkvrfvghakqriqedylrilryfrfygrivdkpgdhdpetleaiaen
    akglagisgeriwvelkkilvgnhvnhlihliydldvapyiglpanasleefdkvsknvd
    gfspkpvtllaslfkvqddvtkldlrlkiakeeknlglfivknrkdlikatdssdplkpy
    qdfiidsrepdattrvcellkyqgehcllkemqqwsippfpvsghdirkvgissgkeiga
    llqqlreqwkksgyqmekdellsyikkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ou5A (A:)
    dkmklqspefqslfteglksltelfvkenhelriaggavrdllngvkpqdidfattatpt
    qmkemfqsagirminnrgekhgtitarlheenfeittlrifttdwqkdaerrdltinsmf
    lgfdgtlfdyfngyedlknkkvrfvghakqriqedylrilryfrfygrivdkpgdhdpet
    leaiaenakglagisgeriwvelkkilvgnhvnhlihliydldvapyiglpanasleefd
    kvsknvdgfspkpvtllaslfkvqddvtkldlrlkiakeeknlglfivknrkdlikatds
    sdplkpyqdfiidsrepdattrvcellkyqgehcllkemqqwsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ou5B (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkmklqspefqslfteglk
    sltelfvkenhelriaggavrdllngvkpqdidfattatptqmkemfqsagirminnrge
    khgtitarlheenfeittlridvttdgrhaevefttdwqkdaerrdltinsmflgfdgtl
    fdyfngyedlknkkvrfvghakqriqedylrilryfrfygrivdkpgdhdpetleaiaen
    akglagisgeriwvelkkilvgnhvnhlihliydldvapyiglpanasleefdkvsknvd
    gfspkpvtllaslfkvqddvtkldlrlkiakeeknlglfivknrkdlikatdssdplkpy
    qdfiidsrepdattrvcellkyqgehcllkemqqwsippfpvsghdirkvgissgkeiga
    llqqlreqwkksgyqmekdellsyikkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ou5B (B:)
    dkmklqspefqslfteglksltelfvkenhelriaggavrdllngvkpqdidfattatpt
    qmkemfqsagirminnrgekhgtitarlheenfeittlrifttdwqkdaerrdltinsmf
    lgfdgtlfdyfngyedlknkkvrfvghakqriqedylrilryfrfygrivdkpgdhdpet
    leaiaenakglagisgeriwvelkkilvgnhvnhlihliydldvapyiglpanasleefd
    kvsknvdgfspkpvtllaslfkvqddvtkldlrlkiakeeknlglfivknrkdlikatds
    sdplkpyqdfiidsrepdattrvcellkyqgehcllkemqqwsi