PDB entry 1ohq

View 1ohq on RCSB PDB site
Description: crystal structure of hel4, a soluble human vh antibody domain resistant to aggregation
Class: immunoglobulin
Keywords: antibody, immune system, fv fragment, hel4, immunoglobulin
Deposited on 2003-05-30, released 2004-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OHQ (0-119)
    Domains in SCOPe 2.08: d1ohqa_
  • Chain 'B':
    Compound: immunoglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OHQ (0-End)
    Domains in SCOPe 2.08: d1ohqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ohqA (A:)
    evqllesggglvqpggslrlscaasgfrisdedmgwvrqapgkglewvssiygpsgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycasaleplseplgfwgqgtlvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ohqB (B:)
    evqllesggglvqpggslrlscaasgfrisdedmgwvrqapgkglewvssiygpsgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycasaleplseplgfwgqgtlvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ohqB (B:)
    evqllesggglvqpggslrlscaasgfrisdedmgwvrqapgkglewvssiygpsgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycasaleplseplgfwgqgtlvtvs