PDB entry 1oca

View 1oca on RCSB PDB site
Description: human cyclophilin a, unligated, nmr, 20 structures
Deposited on 1997-07-07, released 1997-11-19
The last revision prior to the SCOP 1.63 freeze date was dated 1997-11-19, with a file datestamp of 1997-11-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1oca__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oca_ (-)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle