PDB entry 1o3u

View 1o3u on RCSB PDB site
Description: Crystal structure of an hepn domain protein (tm0613) from thermotoga maritima at 1.75 A resolution
Class: unknown function
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, unknown function
Deposited on 2003-03-28, released 2003-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein TM0613
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0613
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ82 (12-134)
      • leader sequence (9-11)
      • modified residue (53)
    Domains in SCOPe 2.08: d1o3ua1, d1o3ua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o3uA (A:)
    mgsdkihhhhhhmdaakddlehakhdlehgfynwacfssqqaaekavkavfqrmgaqawg
    ysvpdflgelssrfeipeelmdhaleldkaciptrypdalpsgsprnrysrieaerlvny
    aekiirfcedllsri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o3uA (A:)
    hhhmdaakddlehakhdlehgfynwacfssqqaaekavkavfqrmgaqawgysvpdflge
    lssrfeipeelmdhaleldkacdalpsgsprnrysrieaerlvnyaekiirfcedllsri