PDB entry 1ny8

View 1ny8 on RCSB PDB site
Description: Solution structure of Protein yrbA from Escherichia Coli: Northeast Structural Genomics Consortium target ER115
Class: Structural genomics, UNKNOWN FUNCTION
Keywords: ER115, NMR Structure, YRBA, AUTOASSIGN, AUTOSTRUCTURE, NESG, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2003-02-11, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein yrbA
  Species: Escherichia coli [TaxId:562]
  Gene: YRBA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A9W6 (0-88)
    • expression tag (89-96)
  Domains in SCOPe 2.08: d1ny8a1, d1ny8a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ny8A (A:)
  miedpmenneiqsvlmnalslqevhvsgdgshfqviavgelfdgmsrvkkqqtvygplme
  yiadnrihavsikaytpaewardrklngflehhhhhh