PDB entry 1noy

View 1noy on RCSB PDB site
Description: DNA polymerase (e.c.2.7.7.7)/DNA complex
Class: transferase/DNA
Keywords: exonuclease, DNA-binding, complex (nucleotidyltransferase/DNA)
Deposited on 1996-02-16, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (DNA polymerase (e.c.2.7.7.7))
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04415
      • conflict (1)
      • conflict (249)
    Domains in SCOPe 2.07: d1noya_
  • Chain 'B':
    Compound: protein (DNA polymerase (e.c.2.7.7.7))
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1noyb_
  • Chain 'S':
    Compound: DNA (5'-d(*tp*tp*t)-3')
  • Heterogens: ZN, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1noyA (A:)
    mdefyisietvgnniveryidengkertreveylptmfrhckeeskykdiygkncapqkf
    psmkdardwmkrmediglealgmndfklayisdtygseivydrkfvrvancdievtgdkf
    pdpmkaeyeidaithydsiddrfyvfdllnsmygsvskwdaklaakldceggdevpqeil
    drviympfdnerdmlmeyinlweqkrpaiftgwniegfdvpyimnrvkmilgersmkrfs
    pigrvkskllqnmygskeiysidgvsildyldlykkfaftnlpsfslesvaqhetkkgkl
    pydgpinklretnhqryisyniidvesvqaidkirgfidlvlsmsyyakmpfsgvmspik
    twdaiifnslkgehkvipqqgshvkqsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1noyA (A:)
    defyisietvgnniveryidengkertreveylptmfrhckeeskykdiygkncapqkfp
    smkdardwmkrmediglealgmndfklayisdtygseivydrkfvrvancdievtgdkfp
    dpmkaeyeidaithydsiddrfyvfdllnsmygsvskwdaklaakldceggdevpqeild
    rviympfdnerdmlmeyinlweqkrpaiftgwniegfdvpyimnrvkmilgersmkrfsp
    igrvkskllqnmygskeiysidgvsildyldlykkfaftnlpsfslesvaqhetkkgklp
    ydgpinklretnhqryisyniidvesvqaidkirgfidlvlsmsyyakmpfsgvmspikt
    wdaiifnslkge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1noyB (B:)
    mdefyisietvgnniveryidengkertreveylptmfrhckeeskykdiygkncapqkf
    psmkdardwmkrmediglealgmndfklayisdtygseivydrkfvrvancdievtgdkf
    pdpmkaeyeidaithydsiddrfyvfdllnsmygsvskwdaklaakldceggdevpqeil
    drviympfdnerdmlmeyinlweqkrpaiftgwniegfdvpyimnrvkmilgersmkrfs
    pigrvkskllqnmygskeiysidgvsildyldlykkfaftnlpsfslesvaqhetkkgkl
    pydgpinklretnhqryisyniidvesvqaidkirgfidlvlsmsyyakmpfsgvmspik
    twdaiifnslkgehkvipqqgshvkqsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1noyB (B:)
    defyisietvgnniveryidengkertreveylptmfrhckegkncapqkfpsmkdardw
    mkrgmndfklayisdtygseivydrkfvrvancdievtgdkfpdpmkaeyeidaithyds
    iddrfyvfdllnsmygsvskwdaklaakldceggdevpqeildrviympfdnerdmlmey
    inlweqkrpaiftgwniegfdvpyimnrvkmilgersmkrfspigrvksklskeiysidg
    vsildyldlykkfaftnlpsfslesvaqhetkkgklpydgpinklretnhqryisyniid
    vesvqaidkirgfidlvlsmsyyakmpfsgvmspiktwdaiifnsl
    

  • Chain 'S':
    No sequence available.