PDB entry 1nog

View 1nog on RCSB PDB site
Description: Crystal Structure of Conserved Protein 0546 from Thermoplasma Acidophilum
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-01-16, released 2003-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.197
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein TA0546
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA1434
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HIA7
      • see remark 999 (109)
      • see remark 999 (158)
    Domains in SCOPe 2.08: d1noga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nogA (A:)
    mftrrgdqgetdlanrarvgkdspvvevqgtidelnsfigyalvlsrwddirndlfriqn
    dlfvlgedvstggkgrtvtremidylearvkemkaeigkielfvvpggsvesaslhmara
    vsrrlerrivaasklteinknvliyanrlssilfmhalisnkrlnipekiwsihrvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nogA (A:)
    spvvevqgtidelnsfigyalvlsrwddirndlfriqndlfvlgedvstggkgrtvtrem
    idylearvkemkaeigkielfvvpggsvesaslhmaravsrrlerrivaasklteinknv
    liyanrlssilfmhalisnkrlnipekiw