PDB entry 1ncn

View 1ncn on RCSB PDB site
Description: the receptor-binding domain of human B7-2
Class: immune system
Keywords: Ig V, beta strands, IMMUNE SYSTEM
Deposited on 2002-12-05, released 2003-03-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: t lymphocyte activation antigen cd86
  Species: Homo sapiens [TaxId:9606]
  Gene: B7-2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42081 (1-109)
    • initiating methionine (0)
  Domains in SCOPe 2.03: d1ncna_
• Chain 'B':
  Compound: t lymphocyte activation antigen cd86
  Species: Homo sapiens [TaxId:9606]
  Gene: B7-2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42081 (1-109)
    • initiating methionine (0)
  Domains in SCOPe 2.03: d1ncnb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ncnA (A:)
  mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg
  rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ncnB (B:)
  mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg
  rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla