PDB entry 1n6u

View 1n6u on RCSB PDB site
Description: NMR structure of the interferon-binding ectodomain of the human interferon receptor
Class: immune system
Keywords: immunoglobulin fold, fibronectin fold, two-domain structure, IMMUNE SYSTEM
Deposited on 2002-11-12, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon-alpha/beta receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNAR2 OR IFNARB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48551 (0-209)
      • cloning artifact (210-211)
    Domains in SCOPe 2.07: d1n6ua1, d1n6ua2, d1n6ua3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6uA (A:)
    sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
    ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfeppefeivgftnh
    invmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyiidklipntnyc
    vsvylehsdeqaviksplkctllppgqesefs