PDB entry 1mwp

View 1mwp on RCSB PDB site
Description: n-terminal domain of the amyloid precursor protein
Class: sugar binding protein
Keywords: heparin binding, sugar binding protein
Deposited on 1999-03-09, released 2000-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid a4 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mwpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwpA (A:)
    llaepqiamfcgrlnmhmnvqngkwdsdpsgtktcidtkegilqycqevypelqitnvve
    anqpvtiqnwckrgrkqckthphfvipyrclvgefv