PDB entry 1mks

View 1mks on RCSB PDB site
Description: carboxylic ester hydrolase, trigonal form of the triple mutant
Class: hydrolase
Keywords: hydrolase, enzyme, carboxylic ester hydrolase, trigonal form
Deposited on 1997-08-27, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Bos taurus [TaxId:9913]
  Gene: PRO-PLA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • engineered (51)
    • engineered (72)
    • engineered (98)
  Domains in SCOPe 2.07: d1mksa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mksA (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncfkqakklds
  ckvlvdnpytnnfsyscsnneitcssennaceaficncnrnaaicfskvpynkehknldk
  knc