PDB entry 1mk0

View 1mk0 on RCSB PDB site
Description: catalytic domain of intron endonuclease I-TevI, E75A mutant
Class: hydrolase
Keywords: alpha/beta fold; CATALYTIC DOMAIN; DNA-BINDING SURFACE, HYDROLASE
Deposited on 2002-08-28, released 2002-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intron-associated endonuclease 1
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13299 (0-96)
      • engineered (74)
    Domains in SCOPe 2.07: d1mk0a_
  • Heterogens: CIT, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mk0A (A:)
    mksgiyqikntlnnkvyvgsakdfekrwkrhfkdlekgchssiklqrsfnkhgnvfecsi
    leeipyekdliieranfwikelnskingyniadatfg