PDB entry 1mfw

View 1mfw on RCSB PDB site
Description: structure of n-terminal doublecortin domain from dclk: selenomethionine labeled protein
Class: transferase
Keywords: Doublecortin, Doublecortin-like kinase, X-ray structure, Microtubule bundling, Cortex development, TRANSFERASE
Deposited on 2002-08-13, released 2003-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.132
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: doublecortin-like kinase (n-terminal domain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15075 (1-106)
      • engineered (72)
    Domains in SCOPe 2.07: d1mfwa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mfwA (A:)
    gtlssekkakkvrfyrngdryfkgivyaispdrfrsfealladltrtlsdnvnlpqgvrt
    iytidglkkissmdqlvegesyvcgsiepfkkleytknvnpnwsvnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mfwA (A:)
    tlssekkakkvrfyrngdryfkgivyaispdrfrsfealladltrtlsdnvnlpqgvrti
    ytidglkkissmdqlvegesyvcgsiepfkkleytknvnpnwsvnv