PDB entry 1md2

View 1md2 on RCSB PDB site
Description: cholera toxin b-pentamer with decavalent ligand bmsc-0013
Class: toxin
Keywords: multivalent inhibitor toxin
Deposited on 2002-08-06, released 2002-12-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.125
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • GB X58785 (0-102)
    Domains in SCOPe 2.03: d1md2d_
  • Chain 'E':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • GB X58785 (0-102)
    Domains in SCOPe 2.03: d1md2e_
  • Chain 'F':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • GB X58785 (0-102)
    Domains in SCOPe 2.03: d1md2f_
  • Chain 'G':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • GB X58785 (0-102)
    Domains in SCOPe 2.03: d1md2g_
  • Chain 'H':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • GB X58785 (0-102)
    Domains in SCOPe 2.03: d1md2h_
  • Heterogens: CYN, 233, SQ, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1md2D (D:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1md2E (E:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1md2F (F:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1md2G (G:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1md2H (H:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman