PDB entry 1m9w

View 1m9w on RCSB PDB site
Description: Study of electrostatic potential surface distribution using high resolution side-chain conformation determined by NMR
Class: electron transport
Keywords: sidechain orientation, congen, ELECTRON TRANSPORT
Deposited on 2002-07-30, released 2002-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin
    Species: Synechocystis sp. [TaxId:1143]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m9wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9wA (A:)
    anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfaadgvdadtaaklshkg
    lafaagesftstftepgtytyycephrgagmvgkvvve