PDB entry 1m10

View 1m10 on RCSB PDB site
Description: Crystal structure of the complex of Glycoprotein Ib alpha and the von Willebrand Factor A1 Domain
Class: blood clotting
Keywords: leucine-rich repeat, HEMOSTASIS, DINUCLEOTIDE BINDING FOLD, BLOOD CLOTTING
Deposited on 2002-06-16, released 2002-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.234
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene: VWF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275
      • engineered (45)
    Domains in SCOPe 2.07: d1m10a_
  • Chain 'B':
    Compound: Glycoprotein Ib alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: GP1BA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07359 (0-End)
      • engineered (20)
      • engineered (158)
      • engineered (238)
    Domains in SCOPe 2.07: d1m10b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m10A (A:)
    disepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmeqlrisqkwvrvavve
    yhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasri
    alllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvl
    ssvdeleqqrdeivsylcdlapeapppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m10A (A:)
    hdfycsrlldlvflldgssrlseaefevlkafvvdmmeqlrisqkwvrvavveyhdgsha
    yiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmas
    qepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdele
    qqrdeivsylcdlapeapp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m10B (B:)
    hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkavt
    snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyypeedtegdkvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m10B (B:)
    hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkavt
    snvasvqcdnsdkfpvykypgkgcptl