PDB entry 1lyq

View 1lyq on RCSB PDB site
Description: Crystal Structure of PcoC, a Methionine Rich Copper Resistance Protein from Escherichia coli
Class: metal binding protein
Keywords: beta barrel, ig domain
Deposited on 2002-06-07, released 2002-11-27
The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.216
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PcoC copper resistance protein
    Species: Escherichia coli
    Gene: plasmid pRJ1004
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lyqa_
  • Chain 'B':
    Compound: PcoC copper resistance protein
    Species: Escherichia coli
    Gene: plasmid pRJ1004
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lyqb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lyqA (A:)
    ahpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkgmsshspmpvaakva
    pgadpksmviipreplpagtyrvdwravssdthpitgnytftvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lyqA (A:)
    ahpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkshspmpvaakvapga
    dpksmviipreplpagtyrvdwravssdthpitgnytftvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lyqB (B:)
    ahpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkgmsshspmpvaakva
    pgadpksmviipreplpagtyrvdwravssdthpitgnytftvk