SCOP 1.73: Domain d1lyqb_: 1lyq B:

Lineage for d1lyqb_ (1lyq B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)

6. Protein Copper resistance protein C (CopC, PcoC) [81970] (2 species)

7. Species Escherichia coli [TaxId:562] [81972] (2 PDB entries)

8. Domain d1lyqb_: 1lyq B: [78303]
   complexed with gol

Details for d1lyqb_

PDB Entry: 1lyq, 1.5 Å

PDB Description: Crystal Structure of PcoC, a Methionine Rich Copper Resistance Protein from Escherichia coli

PDB Compounds: (B:) PcoC copper resistance protein

SCOP Domain Sequences for d1lyqb_:

Sequence; same for both SEQRES and ATOM records:

>d1lyqb_ b.1.18.17 (B:) Copper resistance protein C (CopC, PcoC) {Escherichia coli [TaxId: 562]}
ahpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkgmsshspmpvaakva
pgadpksmviipreplpagtyrvdwravssdthpitgnytftvk

Timeline for d1lyqb_:

• d1lyqb_ first appeared in SCOP 1.63
  
• d1lyqb_ appears in SCOP 1.71
  
• d1lyqb_ appears in SCOP 1.75
  
• d1lyqb_ appears in the current release, SCOPe 2.08