PDB entry 1lxl

View 1lxl on RCSB PDB site
Description: nmr structure of bcl-xl, an inhibitor of programmed cell death, minimized average structure
Class: apoptosis
Keywords: apoptosis, programmed cell death, bcl-2 family
Deposited on 1996-04-04, released 1997-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-xl
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lxla1, d1lxla2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lxlA (A:)
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnps
whladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh