PDB entry 1lky

View 1lky on RCSB PDB site
Description: Structure of the wild-type TEL-SAM polymer
Class: transcription
Keywords: leukemia, tyrosine kinase, transcriptional repression, drug design
Deposited on 2002-04-26, released 2002-06-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription factor etv6
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41212 (0-76)
    • engineered (65)
  Domains in SCOPe 2.04: d1lkya_
• Chain 'B':
  Compound: transcription factor etv6
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41212 (0-76)
    • engineered (46)
  Domains in SCOPe 2.04: d1lkyb_
• Chain 'C':
  Compound: transcription factor etv6
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41212 (0-76)
    • engineered (65)
  Domains in SCOPe 2.04: d1lkyc_
• Chain 'D':
  Compound: transcription factor etv6
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41212 (0-76)
    • engineered (46)
  Domains in SCOPe 2.04: d1lkyd_
• Chain 'E':
  Compound: transcription factor etv6
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41212 (0-76)
    • engineered (65)
  Domains in SCOPe 2.04: d1lkye_
• Chain 'F':
  Compound: transcription factor etv6
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41212 (0-76)
    • engineered (46)
  Domains in SCOPe 2.04: d1lkyf_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lkyA (A:)
  sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
  phsgdrlyellqhilkq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lkyB (B:)
  sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
  phsgdvlyellqhilkq
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lkyC (C:)
  sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
  phsgdrlyellqhilkq
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lkyD (D:)
  sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
  phsgdvlyellqhilkq
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lkyE (E:)
  sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
  phsgdrlyellqhilkq
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lkyF (F:)
  sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
  phsgdvlyellqhilkq